PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.I02474.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family CPP
Protein Properties Length: 768aa    MW: 82703.8 Da    PI: 7.284
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.I02474.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR41.13.6e-13469507341
             TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                     ++ C+CkkskClk+YC Cfaa+++Cs  C+C++C N+++
  Pahal.I02474.2 469 CRCCSCKKSKCLKLYCACFAAKVYCSGLCSCQGCLNNHT 507
                     789*********************************987 PP

2TCR50.63.8e-16553592140
             TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                     ++k+gCnC+ks+ClkkYCeCf++g+ Cs +C+Ce+CkN+ 
  Pahal.I02474.2 553 RHKRGCNCRKSSCLKKYCECFQSGVGCSMSCRCESCKNSF 592
                     589***********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011146.8E-12467508IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.339468593IPR005172CRC domain
PfamPF036385.8E-9470505IPR005172CRC domain
SMARTSM011141.5E-14553594IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-12555591IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 768 aa     Download sequence    Send to blast
MDPPESPPAP AARPPSAAVS LYEDSPVFDF INSLSPIATP KPLGSAQSVQ LFKSSDLVPA  60
SSIFTSPQVN PQREYKPRTR YGYAQLSQGL SPICQRNQIG ISSCIELSGS PTIASENCSP  120
SEYATIYAQL SQGLSPICQR NQIGISSCIE LSGSPTIASE YCSPSEYAII LPSKWPQPIP  180
LGSEILGDAN KQDTDGKADH SPDVGHVKLS STCYDQNGID QLDPSTSGRN VQENELTKQY  240
NDDLAACSLN HLISRSGTGN AVMSKSDLSL EAQQLSWKLR SDKLFMPMDQ GNLEDSRRKL  300
FDGSTGCYIQ SAADDSHVYY AGAAEGVATN HDPKMLPSVI QSQLVSNEYF FDTFKIPSDG  360
MALSDHQCSG MHRRSLFNEK VWTSDLSGQS GSNLHHANIC GDNYMKPPRS PVYALPVSCS  420
ETGLCSSEVN TLIHDDHSSQ KTMPSVDESC QESYKKKRRK LQNGDGGSCR CCSCKKSKCL  480
KLYCACFAAK VYCSGLCSCQ GCLNNHTHEE TVSCIRKRTE SRNPLAFAPT VTRACDSGSD  540
FGDDSNNTPA SARHKRGCNC RKSSCLKKYC ECFQSGVGCS MSCRCESCKN SFGKRKGALL  600
LATEKMDKGA KAKGTRSKEE KLAFHKQDVV SQSGDLTSTE DLFATPSLEP CRSSILLSST  660
CSEPPVSTVG CSSQLHNSQS PMKADVLFSP SETCAMEPIL LDGSSNIQEV SSSCTTKVKV  720
VSPNKKRVSS LQTGTGLSPI VRSGRKLVLK SIPSFPSLTG DADSEPH*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1454458KKKRR
2454459KKKRRK
3455459KKRRK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008665101.10.0PREDICTED: protein tesmin/TSO1-like CXC 2 isoform X1
TrEMBLK4A7550.0K4A755_SETIT; Uncharacterized protein
STRINGSi034711m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.12e-49Tesmin/TSO1-like CXC domain-containing protein